wunder · Library

Part 23

Ghost Stories of an Antiquary · M. R. (Montague Rhodes) James — chapter 23 of 24 · ~2,575 words · public domain

Read in the Wunder reader — free

“Well, Somerton,” said Mr Gregory, as he crossed the room to the door, “I won’t ask for any explanations till you see fit to give them. And if this bit of business is as easy as you represent it to be, I will very gladly undertake it for you the first thing in the morning.”

“Ah, I was sure you would, my dear Gregory; I was certain I could rely on you. I shall owe you more thanks than I can tell. Now, here is Brown. Brown, one word with you.”

“Shall I go?” interjected Mr Gregory.

“Not at all. Dear me, no. Brown, the first thing tomorrow morning—(you don’t mind early hours, I know, Gregory)—you must take the Rector to—there, you know” (a nod from Brown, who looked grave and anxious), “and he and you will put that back. You needn’t be in the least alarmed; it’s perfectly safe in the daytime. You know what I mean. It lies on the step, you know, where—where we put it.” (Brown swallowed dryly once or twice, and, failing to speak, bowed.) “And—yes, that’s all. Only this one other word, my dear Gregory. If you can manage to keep from questioning Brown about this matter, I shall be still more bound to you. Tomorrow evening, at latest, if all goes well, I shall be able, I believe, to tell you the whole story from start to finish. And now I’ll wish you good night. Brown will be with me—he sleeps here—and if I were you, I should lock my door. Yes, be particular to do that. They—they like it, the people here, and it’s better. Good night, good night.”

They parted upon this, and if Mr Gregory woke once or twice in the small hours and fancied he heard a fumbling about the lower part of his locked door, it was, perhaps, no more than what a quiet man, suddenly plunged into a strange bed and the heart of a mystery, might reasonably expect. Certainly he thought, to the end of his days, that he had heard such a sound twice or three times between midnight and dawn.

He was up with the sun, and out in company with Brown soon after. Perplexing as was the service he had been asked to perform for Mr Somerton, it was not a difficult or an alarming one, and within half an hour from his leaving the inn it was over. What it was I shall not as yet divulge.

Later in the morning Mr Somerton, now almost himself again, was able to make a start from Steinfeld; and that same evening, whether at Coblentz or at some intermediate stage on the journey I am not certain, he settled down to the promised explanation. Brown was present, but how much of the matter was ever really made plain to his comprehension he would never say, and I am unable to conjecture.

III

This was Mr Somerton’s story:

“You know roughly, both of you, that this expedition of mine was undertaken with the object of tracing something in connexion with some old painted glass in Lord D——’s private chapel. Well, the starting-point of the whole matter lies in this passage from an old printed book, to which I will ask your attention.”

And at this point Mr Somerton went carefully over some ground with which we are already familiar.

“On my second visit to the chapel,” he went on, “my purpose was to take every note I could of figures, lettering, diamond-scratchings on the glass, and even apparently accidental markings. The first point which I tackled was that of the inscribed scrolls. I could not doubt that the first of these, that of Job—‘There is a place for the gold where it is hidden’—with its intentional alteration, must refer to the treasure; so I applied myself with some confidence to the next, that of St John—‘They have on their vestures a writing which no man knoweth.’ The natural question will have occurred to you: Was there an inscription on the robes of the figures? I could see none; each of the three had a broad black border to his mantle, which made a conspicuous and rather ugly feature in the window. I was nonplussed, I will own, and, but for a curious bit of luck, I think I should have left the search where the Canons of Steinfeld had left it before me. But it so happened that there was a good deal of dust on the surface of the glass, and Lord D——, happening to come in, noticed my blackened hands, and kindly insisted on sending for a Turk’s head broom to clean down the window. There must, I suppose, have been a rough piece in the broom; anyhow, as it passed over the border of one of the mantles, I noticed that it left a long scratch, and that some yellow stain instantly showed up. I asked the man to stop his work for a moment, and ran up the ladder to examine the place. The yellow stain was there, sure enough, and what had come away was a thick black pigment, which had evidently been laid on with the brush after the glass had been burnt, and could therefore be easily scraped off without doing any harm. I scraped, accordingly, and you will hardly believe—no, I do you an injustice; you will have guessed already—that I found under this black pigment two or three clearly-formed capital letters in yellow stain on a clear ground. Of course, I could hardly contain my delight.

“I told Lord D—— that I had detected an inscription which I thought might be very interesting, and begged to be allowed to uncover the whole of it. He made no difficulty about it whatever, told me to do exactly as I pleased, and then, having an engagement, was obliged—rather to my relief, I must say—to leave me. I set to work at once, and found the task a fairly easy one. The pigment, disintegrated, of course, by time, came off almost at a touch, and I don’t think that it took me a couple of hours, all told, to clean the whole of the black borders in all three lights. Each of the figures had, as the inscription said, ‘a writing on their vestures which nobody knew’.

“This discovery, of course, made it absolutely certain to my mind that I was on the right track. And, now, what was the inscription? While I was cleaning the glass I almost took pains not to read the lettering, saving up the treat until I had got the whole thing clear. And when that was done, my dear Gregory, I assure you I could almost have cried from sheer disappointment. What I read was only the most hopeless jumble of letters that was ever shaken up in a hat. Here it is:

Job. DREVICIOPEDMOOMSMVIVLISLCAVIBASBATAOVT St John. RDIIEAMRLESIPVSPODSEEIRSETTAAESGIAVNNR Zechariah. DREVICIOPEDMOOMSMVIVLISLCAVIBASBATAOVT

“Blank as I felt and must have looked for the first few minutes, my disappointment didn’t last long. I realized almost at once that I was dealing with a cipher or cryptogram; and I reflected that it was likely to be of a pretty simple kind, considering its early date. So I copied the letters with the most anxious care. Another little point, I may tell you, turned up in the process which confirmed my belief in the cipher. After copying the letters on Job’s robe I counted them, to make sure that I had them right. There were thirty-eight; and, just as I finished going through them, my eye fell on a scratching made with a sharp point on the edge of the border. It was simply the number xxxviii in Roman numerals. To cut the matter short, there was a similar note, as I may call it, in each of the other lights; and that made it plain to me that the glass-painter had had very strict orders from Abbot Thomas about the inscription, and had taken pains to get it correct.

“Well, after that discovery you may imagine how minutely I went over the whole surface of the glass in search of further light. Of course, I did not neglect the inscription on the scroll of Zechariah—‘Upon one stone are seven eyes,’ but I very quickly concluded that this must refer to some mark on a stone which could only be found in situ, where the treasure was concealed. To be short, I made all possible notes and sketches and tracings, and then came back to Parsbury to work out the cipher at leisure. Oh, the agonies I went through! I thought myself very clever at first, for I made sure that the key would be found in some of the old books on secret writing. The Steganographia of Joachim Trithemius, who was an earlier contemporary of Abbot Thomas, seemed particularly promising; so I got that and Selenius’s Cryptographia and Bacon’s de Augmentis Scientiarum and some more. But I could hit upon nothing. Then I tried the principle of the ‘most frequent letter’, taking first Latin and then German as a basis. That didn’t help, either; whether it ought to have done so, I am not clear. And then I came back to the window itself, and read over my notes, hoping almost against hope that the Abbot might himself have somewhere supplied the key I wanted. I could make nothing out of the colour or pattern of the robes. There were no landscape backgrounds with subsidiary objects; there was nothing in the canopies. The only resource possible seemed to be in the attitudes of the figures. ‘Job,’ I read: ‘scroll in left hand, forefinger of right hand extended upwards. John: holds inscribed book in left hand; with right hand blesses, with two fingers. Zechariah: scroll in left hand; right hand extended upwards, as Job, but with three fingers pointing up.’ In other words, I reflected, Job has one finger extended, John has two, Zechariah has three. May not there be a numeral key concealed in that? My dear Gregory,” said Mr Somerton, laying his hand on his friend’s knee, “that was the key. I didn’t get it to fit at first, but after two or three trials I saw what was meant. After the first letter of the inscription you skip one letter, after the next you skip two, and after that skip three. Now look at the result I got. I’ve underlined the letters which form words:

RVIIOPDOOSMVVISCAVBSBTAOT DIEAMLSIVSPDEERSETAEGIANR FEEALQDVAIMLEATTHOOVMCA.H.Q.E.

“Do you see it? ‘Decem millia auri reposita sunt in puteo in at. . .’ (Ten thousand [pieces] of gold are laid up in a well in …), followed by an incomplete word beginning at. So far so good. I tried the same plan with the remaining letters; but it wouldn’t work, and I fancied that perhaps the placing of dots after the three last letters might indicate some difference of procedure. Then I thought to myself, ‘Wasn’t there some allusion to a well in the account of Abbot Thomas in that book the “Sertum”?’ Yes, there was: he built a puteus in atrio (a well in the court). There, of course, was my word atrio. The next step was to copy out the remaining letters of the inscription, omitting those I had already used. That gave what you will see on this slip:

RVIIOPDOOSMVVISCAVBSBTAOTDIEAMLSIVSPDEERSETAEGIANRFEEALQDVAIMLEATTHOOVM CA.H.Q.E.

“Now, I knew what the three first letters I wanted were—namely, rio—to complete the word atrio; and, as you will see, these are all to be found in the first five letters. I was a little confused at first by the occurrence of two i’s, but very soon I saw that every alternate letter must be taken in the remainder of the inscription. You can work it out for yourself; the result, continuing where the first ‘round’ left off, is this:

‘rio domus abbatialis de Steinfeld a me, Thoma, qui posui custodem super ea. Gare à qui la touche’.

“So the whole secret was out:

‘Ten thousand pieces of gold are laid up in the well in the court of the Abbot’s house of Steinfeld by me, Thomas, who have set a guardian over them. Gare à qui la touche.’

“The last words, I ought to say, are a device which Abbot Thomas had adopted. I found it with his arms in another piece of glass at Lord D——’s, and he drafted it bodily into his cipher, though it doesn’t quite fit in point of grammar.

“Well, what would any human being have been tempted to do, my dear Gregory, in my place? Could he have helped setting off, as I did, to Steinfeld, and tracing the secret literally to the fountain-head? I don’t believe he could. Anyhow, I couldn’t, and, as I needn’t tell you, I found myself at Steinfeld as soon as the resources of civilization could put me there, and installed myself in the inn you saw. I must tell you that I was not altogether free from forebodings—on one hand of disappointment, on the other of danger. There was always the possibility that Abbot Thomas’s well might have been wholly obliterated, or else that someone, ignorant of cryptograms, and guided only by luck, might have stumbled on the treasure before me. And then”—there was a very perceptible shaking of the voice here—’I was not entirely easy, I need not mind confessing, as to the meaning of the words about the guardian of the treasure. But, if you don’t mind, I’ll say no more about that until—until it becomes necessary.

“At the first possible opportunity Brown and I began exploring the place. I had naturally represented myself as being interested in the remains of the abbey, and we could not avoid paying a visit to the church, impatient as I was to be elsewhere. Still, it did interest me to see the windows where the glass had been, and especially that at the east end of the south aisle. In the tracery lights of that I was startled to see some fragments and coats-of-arms remaining—Abbot Thomas’s shield was there, and a small figure with a scroll inscribed Oculos habent, et non videbunt (They have eyes, and shall not see), which, I take it, was a hit of the Abbot at his Canons.

“But, of course, the principal object was to find the Abbot’s house. There is no prescribed place for this, so far as I know, in the plan of a monastery; you can’t predict of it, as you can of the chapter-house, that it will be on the eastern side of the cloister, or, as of the dormitory, that it will communicate with a transept of the church. I felt that if I asked many questions I might awaken lingering memories of the treasure, and I thought it best to try first to discover it for myself. It was not a very long or difficult search. That three-sided court south-east of the church, with deserted piles of building round it, and grass-grown pavement, which you saw this morning, was the place. And glad enough I was to see that it was put to no use, and was neither very far from our inn nor overlooked by any inhabited building; there were only orchards and paddocks on the slopes east of the church. I can tell you that fine stone glowed wonderfully in the rather watery yellow sunset that we had on the Tuesday afternoon.

← Previous chapterAll chaptersNext chapter →

Ghost Stories of an Antiquary · The Wunder Library — complete classics, free to read, with narration.

© 2026 Wunder Learning LLC · Terms & Privacy